PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0184459.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 53aa    MW: 6393.32 Da    PI: 5.6141
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0184459.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM64.53.2e-20753148
              NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                     +ppGfrFhPtdeelv++yL+kk+++k+++l +vik+vd+yk+ePwdL+
  Lj0g3v0184459.1  7 VPPGFRFHPTDEELVDYYLRKKIASKRIDL-DVIKDVDLYKIEPWDLQ 53
                     69****************************.9**************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-19552IPR003441NAC domain
PROSITE profilePS5100522.027753IPR003441NAC domain
PfamPF023651.2E-9850IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKIA SKRIDLDVIK DVDLYKIEPW DLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-156521460Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150347e-49AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011018253.15e-31PREDICTED: NAC domain-containing protein 7-like
RefseqXP_011018254.15e-31PREDICTED: NAC domain-containing protein 7-like
RefseqXP_011018256.15e-31PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-30NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A067DZX01e-31A0A067DZX0_CITSI; Uncharacterized protein (Fragment)
TrEMBLA3A9I43e-31A3A9I4_ORYSJ; Uncharacterized protein
STRINGPOPTR_0001s00220.12e-30(Populus trichocarpa)
STRINGGLYMA11G03340.12e-30(Glycine max)
STRINGLOC_Os02g42970.13e-30(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.17e-32NAC 007